Help RSS API Feed Maltego Contact                        

Domain > bwslnjejcaxervwscvwpsdpdrrinrwcwfrnefimlfhcphknfrouifh.zhangyaodong8.com

More information on this domain is in AlienVault OTX

Is this malicious?

DNS Resolutions

DateIP Address
2024-04-23111.177.8.41 (ClassC)
2025-10-0138.207.43.195 (ClassC)
View on OTX | View on ThreatMiner








Data with thanks to AlienVault OTX, VirusTotal, Malwr and others. [Sitemap]



� Copyright 2019 AlienVault, Inc. | Legal| Status| Do Not Sell My Personal Information