Domain > activecomputers.cz

Welcome! Right click nodes and scroll the mouse to navigate the graph.

More information on this domain is in AlienVault OTX

DNS Resolutions

Date	IP Address
2025-01-31	81.2.195.132 (ClassC)

Port 80

HTTP/1.1 200 OKCache-Control: privateContent-Length: 3215Content-Type: text/htmlServer: Microsoft-IIS/7.5Set-Cookie: ASPSESSIONIDSQSQQACAICMNNIKAANNLIDFAGIPIHKCG; path/X-Powered-By: ASP.NETDate: Sun,

!DOCTYPE HTML PUBLIC -//W3C//DTD HTML 4.0 Transitional//EN>html>head>meta http-equivContent-Type contenttext/html; charsetwindows-1250>title>Active Computers - Webdesign & SEO - Po��ta�e - S�t� & Slu�by/title>link relstylesheet typetext/css hrefactive.css>/head>body>div classwindow>div classtop>	a href../ titleActive Computers - Webdesign & SEO - Po��ta�e - S�t� & slu�by - �vodn� str�nka>img stylemargin-top: 25px; margin-left: 25px srcimages/active-computers-logo.gif width130 height52 altActive Computers - Webdesign & SEO - Po��ta�e - S�t� & slu�by - �vodn� str�nka>/a>/div>div classmenu styletext-align: left>	img classmenu stylemargin-left: 40px; display: none srcimages/reference.gif width93 height16 altReference - N�kter� realizovan� zak�zky z oblasti webdesignu a SEO>	img classmenu stylemargin-left: 40px; display: none srcimages/kontakt.gif width73 height16 altKontakt - Napi�te n�m>/div>div styledisplay: none>noscript>div>/div>/noscript>/div>	div classmain>div styleposition: absolute; top: 2px; left: 2px; width: 300px; height: 135px; background-color: white>	img stylefloat: left; margin: 7px 10px 2px 10px srcimages/lcd.gif width60 height60>	h1 stylemargin-left: 90px>Webdesign & SEO/h1>	p>		Tvorba webov�ch str�nek (wedesign, tvorba webu) pat�� k hlavn�m bod�m na�� nab�dky. Va�e www str�nky by m�ly p�edev��m p�iv�st nov� z�kazn�ky, proto		se kvalitn� web neobejde ani bez optimalizace pro vyhled�va�e (SEO), registrace do internetov�ch katalog� �i monitoringu n�v�t�vnosti.	/p>/div>div styleposition: absolute; top: 138px; left: 2px; width: 300px; height: 135px; background-color: #eaeaea>	img stylefloat: left; margin: 12px 10px 2px 10px srcimages/ntb2.gif width60 height53>	h1 stylemargin-left: 90px>Po��ta�e/h1>	p>		Na�e z�kazn�ky dok�eme uspokojit tak� v oblasti hardware a software.br>		V na�� nab�dce najdete po��ta�e, monitory, LCD displeje, notebooky, tisk�rny, skenery a dal�� periferie, komponenty a p��slu�enstv� k Va�emu PC.br>		Po��ta�ov� sestavy �ijeme p��mo na m�ru dle po

View on OTX | View on ThreatMiner

Data with thanks to AlienVault OTX, VirusTotal, Malwr and others. [Sitemap]

Domain > activecomputers.cz

Is this malicious?

DNS Resolutions

Port 80